Kids encyclopedia facts:Basic English combined wordlist facts for kids

Kids Encyclopedia Facts
Shortcut:
BE 1500

This is the maximum Basic English combined wordlist. It is what the advanced student will know when moving from Basic English to the standard English language. So any student who knows all of these words has gone far beyond Basic English.

It actually contains well over 2,600 words and combines five separate word lists:

  • 50 international nouns.
  • 12 names of sciences.
  • 12 title and organizational names.
  • 50 general utility names.
  • 5 onomatopoeic (sounds like) words.
  • 50 words about time and numbers.
  • 1293 words used as an addendum.
  • 215 compound words (made up of Basic English words).
  • 91 new words made from adding the allowed endings: -er, -ed, -ing, -ly, -s, and the prefix un-.

Total: 2626 words.




Top - 0-9 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

A

Basic: aableaboutaccountacidacrossactadditionadjustmentadvertisementagreementafteragainagainstairallalmostamongamountamusementangleanimalanswerandangryantanyapparatusappleapprovalarchargumentarmarmyartasatattackattemptattentionattractionauthorityautomaticawake

International: alcoholalgebraaluminiumammoniaanestheticAprilarithmeticasbestosAugustautobusautomobile

Addendum: absenceabsorptionaccelerationacceptanceaccessoryaccidentactiveaddressadjacentadventureadviceageagentagencyagoallowancealongalsoalternativealwaysambitionamplitudeanchorankleappendageapplicationapproximationarbitrationarbitraryarcareaarrangementashassetassistantaverageawkwardaxis

Compound: afterthoughtairplaneanotheranybodyanyhowanyoneanythinganywhere

Endings: actoracting

B

Basic: babybackbadbagbalanceballbandbasebasinbasketbathbebeautifulbecausebedbeebeforebehaviorbeliefbellbentberrybetweenbirdbirthbitbitebitterblackbladebloodblowblueboardboatbodybonebookbootboilingbottleboxboybrainbrakebranchbrassbreadbreathbrickbridgebrightbrokenbrotherbrownbrushbucketbuildingbulbbuttonburnburstbusinessbutbutterby

International: balletbangbankbarbeefbeerbiologybomb

Addendum: balconybalebankruptbarkbarrelbeakbeakerbeardbeatbehindbeltbetbillbirefringenceblameblanketbothbottombravebreakbreakfastbreastbrokerbubblebudbudgetbuoyancybunchburialbusy

Compound: backbonebackwoodsbecomebedroombeeswaxbirthdaybirthrightblackberryblackbirdblackboardbloodvesselbluebellbookkeeperbrushwoodbuttercup

Endings: basingbasedbuilderburnerburnedburning

C

Basic: cakecameracanvascardcarecarriagecartcatcausecertainchainchalkchancechangecheapcheesechemicalchestchiefchinchurchcircleclothcleanclearclockcloudcoalcoatcoldcollarcolorcombcomecomfortcommitteecommoncompanycomparisoncompetitioncompletecomplexconditionconnectionconsciouscontrolcookcoppercopycordcorkcottoncoughcountrycovercowcrackcreditcrimecruelcrushcrycupcurrentcurtaincurvecushioncut

International: cafecalendarcatarrhcenti-champagnechauffeurcheckchemistchemistrychocolatechoruscigarettecircuscitronclubcocktailcoffeecognaccollegecolony

Addendum: calculationcallcapacitycapitalcarpetcartilagecasecastcavecavitycellceremonycertificatechaircharacterchargechildchimneychinachoicecirculationcircuitcircumferencecivilizationclayclaimclawcleavagecleverclientclimberclipcodecoilcollisioncollectioncolumncombinationcombinecommunicationscomplaintcomponentcompoundconceptconcreteconductorcongruentconservationconsignmentconstantconsumercontinuouscontourconvenientconversioncoolcornercorrelationcorrosioncostcourtcreepercropcrosscunningcuspcustoms

Compound: cardboardcarefreecaretakerclockworkcommonsensecopyrightcupboard

Endings: carterclothierclothingcookercookedcookingcrying

D

Basic: damagedangerdarkdaughterdaydeaddeardeathdebtdecisiondeepdegreedelicatedependentdesigndesiredestructiondetaildevelopmentdifferentdigestiondirectiondirtydiscoverydiscussiondiseasedisgustdistancedistributiondivisiondodogdoordowndoubtdraindrawerdressdrinkdrivingdropdrydust

International: danceDecemberdeci-degree • Dominion • dynamite

Addendum: dampingdatedebitdeckdecreasedefectdeficiencydeflationdegenerate • delivery • demanddenominatordepartmentdesertdensitydeposit • determining • dewdiameterdifferencedifficultydriftdikedilutiondinnerdipdirect • disappearance • discharge • discountdisgracedislikedissipationdisturbanceditchdivedivisordivorcedoll • domesticating • dreadfuldreamductdullduty

Compound: daylightdownfall

Endings: dancerdancing (to) • designer • dressing (up) • driverdropped • dropper • duster

E

Basic: earearlyeartheastedgeeducationeffecteggelasticelectricendengineenoughequalerroreveneventevereveryexampleexchangeexistenceexpansionexperienceexperteye

International: eightelectricityelevenEmbassyEmpireencyclopediaengineer

Addendum: eacheasyeconomyefficiencyefforteithereliminationemployeremptyenemyenvelopeenvironmentenvyequationerosioneruptionevaporationeveningexactexcitementexperimentexerciseexplanationexplosionexportexpressionextinctioneyebroweyelash

Compound: earringearthworkevergreeneverybodyeverydayeveryoneeverythingeverywhereeyeball

F

Basic: facefactfallfalsefamilyfarfarmfatfatherfearfeatherfeeblefeelingfemalefertilefictionfieldfightfingerfirefirstfishfixedflagflameflatflightfloorflowerflyfoldfoodfoolishfootforforceforkformforwardfowlframefreefrequentfriendfromfrontfruitfullfuture

International: FebruaryfifteenfifthfiftyfivefourfourteenfourthfortyFriday

Addendum: factorfailurefairfamousfanfasteningfaultferment • fertilizing • feverfiberfigurefinfinancialflashflaskfleshflintfloodflourflowfocus • foliation • forecastforeheadforeignforgivenessfractionfracturefreshfrictionfrostfrozenfumefunnelfunnyfurfurnacefurniturefusion

Compound: fatherlandfingerprintfirearmfire-enginefireflyfiremanfireplacefirework • first-rate • football • footlights • footman • footnotefootprint • footstep

Endings: farmer • fisher/fisherman • folder • firedfiring

G

Basic: gardengeneralgetgirlgiveglassglovegogoatgoldgoodgovernmentgraingrassgreatgreengrey/graygripgroupgrowthguidegun

International: gasGeographyGeologyGeometrygramglycerin

Addendum: gategenerationgermgerminatinggillglacierglandgodgrandgrateful • grating • gravelgreasegriefgrocerygroovegrossgroundguardguaranteeguessgum

Compound: gasworks • goldfishgoodlookinggood-morninggoodnight • gunboat • gun-carriage • gunmetalgunpowder

Endings: gardener

H

Basic: hairhammerhand • hanging • happyharborhardharmonyhathatehaveheheadhealthyhearingheartheathelphere • high • historyholehollowhookhopehornhorsehospitalhourhousehowhumor

International: halfhisshotelhundredhyenahygienehysteria

Addendum: habithandkerchiefhandleheavyhedgehillhingehireholdholidayhomehonesthoneyhoofhosthumanhunthurryhurthusband

Compound: handbookhandwriting • headdress • headlandheadstone • headway • hereafter • herewith • highlands • highwayhimself • horseplay • horsepowerhourglass • houseboat • housekeeperhowever

Endings: hanger • heater • heatedheating

I

Basic: Iiceideaifillimportantimpulseinincreaseindustryinkinsectinstrumentinsuranceinterestinventionironisland

International: Imperialinfernoinfluenzainternational

Addendum: igneousimageimaginationimportimpurity • inclusion • indexindividualinflationinfinityinheritanceinnocentinstitutioninsulatorintegerintelligent • intercept • interpretationintersectionintrusioninvestigationinvestmentinverse • invitation

Compound: inasmuch • incomeindoorsinlandinletinputinsideinstepintoitself

Endings: inner

J

Basic: jellyjeweljoin • journey • judgejump

International: JanuaryjazzJulyJune

Addendum: jamjawjealousjerkjointjugjuicejuryjustice

Endings: jewelerjoiner

K

Basic: keepkettlekeykickkindkisskneeknifeknotknowledge

International: kilo-king

Addendum: kennelkidneykitchenknock

Endings: keeper

L

Basic: landlanguagelastlatelaughlawleadleaflearningleastleatherleglessleftletletterlevellibraryliftlightlikelimitlinelinenlipliquidlistlittlelivinglocklonglooklooselossloudlove • low

International: latitudelavaliterliqueurlongitude

Addendum: lace • lag • lakelamelamplargelatitudelawyerlayerlazylecturelegallengthlenslessonleverliabilitylicenselidlifelimelimestonelinkliverloadlocalloanlocuslongitudelucklumplunchlung

Compound: landmarklandsliplighthouselooking-glass

Endings: laughing (at) • learnerlockerlocking (up)

M

Basic: machinemanmanagermakemalemapmarkmarketmarriedmatchmaterialmassmaymealmeasuremeatmedicalmeetingmemorymetalmiddlemilitarymilkmindmineminutemistmixedmoneymonkeymonthmoonmoremorningmostmothermotionmountainmouthmovemuchmusclemusic

International: macaronimadammagneticmalaria • mania • MarchmathematicsMaymetermeowmicro-microscopemilli-millionminuteMondaymuseum

Addendum: magicmagnitudemannermanymarblemarginmarriagemastmattressmaturemeanmeaningmedicinemediummeltmembermessmessagemetabolismmillmineralmixturemodelmodernmodestmomentummonopolymoodmoralmoustachemudmultiplemultiplicationmurder

Compound: manholemyself

Endings: markedminer

N

Basic: nailnamenarrownationnaturalnearnecessaryneckneedneedlenervenetnewnewsnight • no • noisenormalnorthnosenotnotenownumbernut

International: neutronnickelnicotinenineNovember

Addendum: nastynaturenavyneatneglectneighbornestnextnicenodenostrilnucleusnumeratornurse

Compound: networknewspapernobodynothingnowhere

Endings: nearernoted

O

Basic: observationofoffofferofficeoiloldononlyopenoperationopinionoppositeororangeorderorganizationornamentotheroutovenoverowner

International: Octoberoliveonceomeletoneopera • opium • orchestraorganism

Addendum: obedientofficerorchestraoreorganorigin • outcrop • outlier • overlapovalownoxidation

Compound: offspring • oncoming • oneself • onlookeronto • outburst • outcomeoutcryoutdoor • outgoing • outhouseoutlawoutlet • outline • outlook • outputoutside • outskirts • outstretched • overacting • overall • overbalancing • overbearing • overcoatovercome • overdo • overdressed • overfull • overhanging • overheadoverland • overleaf • overloud • overseas • overseer • overshoe • overstatement • overtake • overtaxed • overtime • overturned • overuse • overvalued • overweight • overworking

Endings: outer

P

Basic: pagepainpaintpaperparallelparcelpartpastpastepaymentpeacepenpencilpersonphysicalpicturepigpinpipeplaceplaneplantplateplaypleasepleasureplough/plowpocketpointpoisonpolishpoliticalpoorporterpositionpossiblepotpotatopowderpowerpresentpriceprintprisonprivateprobableprocessproduceprofitpropertyproseprotest • public • pullpumppunishmentpurposepushput

International: pajamasparaffinparadiseparkpassportpatentpenguinpetroleumphonographPhysicsPhysiologypianoplatinumpolicepostpotashPresidentPrincePrincessprogrampropagandaPsychologyPurrpyramid

Addendum: packingpadpairpanparagraphparentparticlepartnerpartypassagepathpatiencepedalpendulumpensionpeopleperfectpetalpistonplainplanplasterplugpoetrypollenpoolpopulationporcelainpracticepraiseprayerpressure • prick • priestprimeprobabilityproductprogressprojectileprojectionpromiseproofproudpulleypupilpurchasepure

Compound: pincushionplaythingpolicemanpostmanpostmarkpostmasterpostoffice

Endings: painterpaintingpartingplayingplayedpleased (with) • pointer • pointing (at) • potterprinterprisonerproducer

Q

Basic: qualityquestionquickquietquite

International: quackquarterqueenquinine

Addendum: quantityquotient

R

Basic: railrainrangeratraterayreactionredreadingreadyreasonreceiptrecordregretregularrelationreligionrepresentativerequestrespectresponsiblerestrewardrhythmricerightringriverroadrodrollroofroomrootroughroundrubrulerun

International: radioradiumreferendumrestaurantrheumatismRoyalrum

Addendum: raceradiationratioreagentreal • receiver • reciprocalrectangle • recurring • reference • reflux • reinforcementrelativeremarkremedyrentrepairreproduction • repulsion • resistance • residue • resolutionresultretailrevengereversiblerich • rigidity • riserivalrockrotrotationruderust

Compound: runaway

Endings: rainingreaderreading • roller • rulerrubber

S

Basic: sadsafesailsaltsamesandsayscaleschoolsciencescissorsscrewseaseatsecondsecretsecretaryseeseedselectionselfsendseemsenseseparateseriousservantsexshadeshakeshamesharpsheepshelfshipshirtshockshoeshortshutsidesignsilksilversimplesistersizeskinskirtskysleepslipslopeslowsmallsmashsmellsmilesmokesmoothsnakesneezesnowsosoapsocietysocksoftsolidsomesonsongsortsoundsoupsouthspacespadespecialspongespoonspringsquarestagestampstarstartstatementstationsteamsteelstemstepstickstickystiffstillstitchstockingstomachstonestopstorestorystraightstrangestreetstretchstrongstructuresubstancesuchsuddensugarsuggestionsummersunsupportsurprisesweetswimsystem

International: saladsardineSaturdaysecondSeptemberserumsevensirsixsixteensportSunday

Addendum: sac • salesamplesatisfactionsaturated • saucer • savingscalescarpschistscratchscreensealsearchsecuritysecretionsectionsedimentaryselfishsensitivitysentencesepalservicesetshadowshaleshareshaveshearsheetshellshoreshouldershowsight • sill • similaritysinceskullslatesleeveslidesocialsoilsoldiersolutionsolventsorryspark • specialization • specimen • speculationspiritspitsplashspotstablestainstair • stalk • stamenstatisticssteadystimulusstormstrainstrawstreamstrengthstressstrikestringstudysubjectsubstitutionsubtractionsuccesssuccessive • sucker • sumsupplysurfacesurgeon • suspension • suspiciousswellingswingswitchsympathetic

Compound: seaman • secondhand • shorthandsideboardsidewalk • somebody • someday • somehow • someone • something • sometime • somewhatsomewhere • suchlike • sunburnsunlightsunshade • sweetheart

Endings: sailorshockingshockedsnowing • steamer • stopper • stopping • stopping up • stretcher

T

Basic: tabletailtaketalktalltastetaxteachingtendencytestthanthatthethentheorytherethickthinthingthisthoughthoughtthreadthroatthroughthumbthundertickettighttiredtilltimetintotoetogethertomorrowtonguetoothtoptouchtowntradetraintransporttraytreetricktrouserstruetroubleturntwist

International: tapiocataxiteatelegramtelephonetenterracetheaterthermometerthirdthirteenthirtythousandthreeThursdaytoasttobaccotorpedoTuesdayturbinetwenty-onetwelvetwentytwicetwo

Addendum: tailortametapteartenttermtexturethicknessthiefthimblethoraxthreatthrusttidetietissuetongstoototaltoweltowertraffictragedytransmissiontransparenttraptraveltreatmenttriangletrucktubetunetunneltwintypist

Compound: todaytonighttradesman

Endings: talking (of) • teachertouching (up) • tradertrainertrainingtroublingtroubledturning (over)

U

Basic: umbrellaunderunitupuse

International: university

Addendum: uglyunconformityunderstandinguniverseunknown

Compound: underclothing • undercooked • undergoundergrowthundermined • undersigned • undersized • understatement • undertake • undervalued • undoupkeepupliftuponupright • uptake

Endings: used (to)

V

Basic: valueverseveryvesselviewviolentvoice

International: vanillaviolinvisavitaminvodkavolt

Addendum: valencyvalleyvalvevaporvariablevascularvegetablevelocityvestigialvictimvictoryvolumevortexvote

Compound: viewpoint

W

Basic: walkwallwaitingwarwarmwashwastewatchwaterwavewaxwayweatherweekweightwellwestwetwhatwheelwhenwherewhichwhilewhipwhistlewhitewhowhywidewillwindwindowwinewingwinterwirewisewithwomanwoodwoolwordworkwormwoundwritingwrong

International: Wednesdaywhisky

Addendum: weakwedgewelcomewhetherwholesalewidowwifewildworldwreckwrist

Compound: waterfallweekendwell-beingwell-offwhateverwheneverwhereaswherebywhereverwhicheverwhitewashwhoeverwindpipewithinwithoutwoodworkworkhouse

Endings: waiterworkerworking (on) working (out) / working (up) • writerwaitingwasted

X, Y, Z

Basic: yearyellowyesyesterdayyouyoung

International: zebrazinczoology

Addendum: yawn

Compound: x-rayyearbookyourselfzookeeper

Related pages